Analytical Data
-
Gene name
CHRM5
- Application
-
Alternative Names
CHRM5;Muscarinic acetylcholine receptor M5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08912
-
Expression Region
1-532aa
-
AA Sequence
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
-
Molecular Weight
66.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHRM5, or Cholinergic Receptor Muscarinic 5, is a subtype of the muscarinic acetylcholine receptors, which play a critical role in various physiological processes in the central and peripheral nervous systems. This receptor is heavily implicated in cognitive functions, including memory and learning, and has been associated with several neurological disorders, such as Alzheimer's disease and schizophrenia. The study of CHRM5, particularly through the production of recombinant proteins, is crucial for understanding its structure, function, and mechanisms of action. Recombinant CHRM5 proteins provide an invaluable tool for elucidating receptor-ligand interactions and downstream signaling pathways. Moreover, they facilitate the development of targeted therapeutic strategies that could address cholinergic system dysfunctions. Advances in genetic engineering and protein expression systems have enabled the generation of highly pure and functional CHRM5 proteins, which can be used in binding assays, cellular signaling studies, and drug discovery efforts. Investigating the role of CHRM5 in various biological contexts through these recombinant proteins can enhance our understanding of its potential as a drug target for treating cognitive impairments and other related diseases. The ongoing research in this domain underscores the importance of CHRM5 as a candidate for therapeutic intervention, highlighting its relevance in neuropharmacology and disease modeling.











