Cat: PA2000-686DB

Recombinant Human GRPR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GRPR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GRPR;Gastrin-releasing peptide receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P30550

  • Expression Region

    1-384aa

  • AA Sequence

    MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVI ILIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASR YLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPMDIQA SHALMKICLKAAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYP HSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQSAYNLPVEGNI HVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLH FVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHS TGRSTTCMTSLKSTNPSVATFSLINGNICHERYV

  • Molecular Weight

    68 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Gastrin-releasing peptide receptor (GRPR) is a member of the bombesin receptor family and is primarily known for its role in various physiological processes, including the regulation of gastrin release and modulation of gastric motility. GRPR has garnered significant attention in cancer research, particularly due to its overexpression in several malignancies, including prostate, breast, and non-small cell lung cancers. This overexpression presents GRPR as a promising target for novel diagnostic and therapeutic strategies. In recent years, the development of GRPR-targeted imaging and therapy, utilizing radiolabeled peptides and small molecules, has shown potential in improving tumor visualization and treatment effectiveness. Furthermore, GRPR is implicated in neurogenic inflammation and the central nervous system's regulation, paving the way for research on its role in neurological disorders. Investigating GRPR and its signaling pathways may lead to breakthroughs in understanding tumor biology and enhancing targeted therapies, thereby offering new hope for patients suffering from GRPR-expressing cancers. As a result, GRPR-based research continues to expand, aiming to uncover its full potential in clinical applications and improve patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US