Analytical Data
-
Gene name
esxC
- Application
-
Alternative Names
esxC;esaC;Type VII secretion system extracellular Protein C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0C051
-
Expression Region
1-130aa
-
AA Sequence
MNFNDIETMVKSKFKDIKKHAEEIAHEIEVRSGYLRKAEQYKRLEFNLSFALDDIESTAKDVQTAKSSANKDSVTVKGKAPNTLYIEKRNLMKQKLEMLGEDIDKNKESLQKAKEIAGEKASEYFNKAMN
-
Molecular Weight
22.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The esxC gene is part of the ESX (Type VII secretion system) family, which plays a pivotal role in the virulence of various pathogenic bacteria, particularly within the Mycobacterium genus, such as Mycobacterium tuberculosis. Research on esxC and its encoded protein focuses on understanding the molecular mechanisms behind bacterial pathogenesis and immune evasion. The ESX systems are responsible for the secretion of specific proteins that aid in the survival of bacteria within host cells and contribute to inflammatory responses. The functional characterization of esxC is essential, as it can provide insights into how these proteins interact with host immune systems and may reveal novel targets for therapeutic interventions. Furthermore, studying esxC could illuminate the evolutionary adaptations of mycobacteria to overcome host defenses, thus informing vaccine development and strategies to combat antibiotic resistance. Understanding its structure and the role it plays within the ESX secretion system is critical for developing an integrated approach to combat infections caused by pathogens that exploit this system. Overall, the investigation of esxC and its protein products is a vital area of research with implications for microbiology, immunology, and medical research aimed at addressing global health challenges posed by mycobacterial diseases.











