Cat: PA2000-634DB

Recombinant Human DNASEII Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DNASEII

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DNASEII;DNASE2A;DNL2;Deoxyribonuclease-2-alpha

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00115

  • Expression Region

    1-360aa

  • AA Sequence

    MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQ YKYLDESSGGWRDGRALINSPEGAVGRSLQPLYRSNTSQLAFLLYNDQPP QPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPASSAAYSWPHSA CTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENV VKGHHVSQEPWNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTN LQVQFWHKTVGILPSNCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCV SPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGM ARKPSRAYKI

  • Molecular Weight

    66 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DNase II is an enzyme that plays a crucial role in the degradation of extracellular deoxyribonucleic acid (DNA) in various biological contexts, including cellular turnover and immune response. This endonuclease is particularly essential for the processing of apoptotic cells, as it facilitates the digestion of DNA released during programmed cell death, thereby preventing potential inflammatory responses and autoimmune diseases. Research into recombinant DNase II has gained traction due to its therapeutic potential; for instance, recombinant forms of this enzyme are being explored for their utility in clearing nucleic acids from the bloodstream in conditions characterized by excessive cell death or during certain viral infections. Furthermore, understanding the structural and functional properties of DNase II can provide insights into its mechanism of action and its interaction with substrates, paving the way for the development of enzyme inhibitors or activators that could be beneficial in treating diseases associated with aberrant DNA accumulation. Several studies have focused on the cloning, expression, and purification of DNase II, employing various expression systems to produce active recombinant proteins for functional assays. As our understanding of the enzyme’s role in both health and disease deepens, DNase II continues to be a promising target in the field of biomedicine, with ongoing research aimed at unlocking its full therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US