Analytical Data
-
Gene name
esxB
- Application
-
Alternative Names
esxB；Beta-2-microglobulin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0C047
-
Expression Region
1-104aa
-
AA Sequence
MGGYKGIKADGGKVDQAKQLAAKTAKDIEACQKQTQQLAEYIEGSDWEGQFANKVKDVLLIMAKFQEELVQPMADHQKAIDNLSQNLAKYDTLSIKQGLDRVNP
-
Molecular Weight
19.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EsxB is a critical protein derived from the pathogenic strains of Mycobacterium tuberculosis (M. tb), the bacterium responsible for tuberculosis (TB). Research into EsxB is important because it is part of the ESX (type VII secretion system) family, which plays a pivotal role in the virulence and survival of M. tb within host cells. The ESX system facilitates the translocation of proteins across the bacterial cell membrane, allowing the pathogen to manipulate host immune responses and promote infection. Studies have shown that EsxB, along with its partner EsxA, can influence the host's immune response, potentially evading detection by the immune system. Understanding the structure, function, and mechanisms of action of EsxB can provide insights into how M. tb establishes and maintains infection. Moreover, the exploration of EsxB as a potential target for vaccine development is gaining interest, as it may lead to novel therapeutic strategies against TB. Given the global prevalence of tuberculosis and the growing issue of antibiotic resistance, ongoing research into EsxB and its role in pathogenesis is essential for developing innovative approaches to control and prevent this deadly disease.
