Analytical Data
-
Gene name
LRRC46
- Application
-
Alternative Names
LRRC46Leucine-rich repeat-containing protein 46
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96FV0
-
Expression Region
1-321aa
-
AA Sequence
MSGGKSAQGPEEGGVCITEALITKRNLTFPEDGELSEKMFHTLDELQTVRLDREGITTIRNLEGLQNLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSENLIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDEASSDEEFPELSGPFCSERGFLKELEQELSRHREHRQQTALTEHLLRMEMQPTLTDLPLLPGVPMAGDSSPSATPAQGEETVPEAVSSPQASSPTKKPCSLIPRGHQSSFWGRKGARAATAPKASVAEAPSTTKTTAKRSKK
-
Molecular Weight
61.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LRRC46, or Leucine-Rich Repeat Containing 46, is a protein that has garnered increasing interest in the field of immunology and cellular biology due to its potential roles in immune regulation and signal transduction. Initially identified through genomic studies, LRRC46 is characterized by its leucine-rich repeat motifs, which are known to mediate protein-protein interactions. Research has suggested that LRRC46 may be involved in the development and function of various immune cells, including T cells and B cells, potentially influencing immune responses and tolerance. Recent studies have highlighted its involvement in key signaling pathways, and its expression patterns in different immune cell lineages suggest a regulatory role in immune system homeostasis. Furthermore, alterations in LRRC46 expression or function may be implicated in various diseases, including autoimmune disorders and cancers, making it a candidate for therapeutic targeting or biomarker development. Ongoing research aims to elucidate the molecular mechanisms underlying LRRC46's functions and its contributions to the immune landscape, which could provide insights into novel strategies for modulating immune responses in disease contexts.











