Cat: PA1000-2152

Recombinant Human NIT2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NIT2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NIT2;Omega-amidase NIT2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NQR4

  • Expression Region

    1-276aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMTSFRLALIQLQISSIKSDNVTRACSF IREAATQGAKIVSLPECFNSPYGAKYFPEYAEKIPGESTQKLSEVAKECS IYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQ ESKTLSPGDSFSTFDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPG AFNLTTGPAHWELLQRSRAVDNQVYVATASPARDDKASYVAWGHSTVVNP WGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NIT2, a member of the transition metal-dependent nitroreductase family, has garnered significant interest in recent years due to its potential applications in bioremediation and biotechnology. This enzyme is known for its ability to catalyze the reduction of nitro compounds, which are prevalent environmental pollutants arising from industrial activities and agricultural runoff. In bacterial systems, NIT2 plays a critical role in the metabolism of these compounds, necessitating a deeper understanding of its biochemical properties and mechanisms of action. Research into NIT2 has aimed to elucidate its structure-function relationship, thereby providing insights into its catalytic activity and substrate specificity. Advances in techniques such as recombinant DNA technology have facilitated the production of NIT2 as a recombinant protein, allowing for more detailed studies using various biophysical and biochemical methods. Moreover, as environmental concerns regarding nitro compound pollution continue to rise, NIT2's potential applications offer promising avenues for developing bioremediation strategies. By harnessing the unique properties of this enzyme, researchers aspire to create bio-based solutions that can effectively mitigate the adverse effects of nitro pollutants, contributing to a cleaner and more sustainable environment. This area of research highlights the intersection of protein engineering, environmental science, and biotechnology, making NIT2 a focal point in the quest for effective biodegradation technologies. As studies progress, the findings may lead to novel applications that extend beyond environmental remediation, potentially impacting areas such as pharmaceuticals and industrial processes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US