Analytical Data
-
Gene name
P/V
- Application
-
Alternative Names
P/V;C6orf135;CAT60;Ribonuclease P Protein subunit p21
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H633
-
Expression Region
1-154aa
-
AA Sequence
MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ
-
Molecular Weight
17.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
P/V recombinant proteins are proteins derived from the polymerase (P) and vitronectin (V) genes of certain viruses, such as the paramyxovirus family. The study of these proteins is crucial because they play significant roles in viral replication and pathogenesis. Understanding the interactions between P and V proteins is essential for elucidating the mechanisms through which these viruses evade the host immune system and establish infections. Researchers have focused on these proteins due to their potential as targets for antiviral drug development and vaccine design. The ability to produce P/V recombinant proteins in laboratory settings allows for detailed biochemical and structural studies, enabling scientists to investigate their function, interactions, and the underlying molecular mechanisms of viral diseases. Additionally, insights gained from these studies may contribute to the design of novel therapeutic strategies, improving our capacity to combat viral infections and mitigate their impact on public health. As such, the research surrounding P/V recombinant proteins not only enriches our understanding of virology but also holds promise for the development of effective countermeasures against viral pathogens.











