Analytical Data
-
Gene name
PRKAa2
- Application
-
Alternative Names
PRKAa2；AMPK；AMPK2；5'-AMP-activated Protein kinase catalytic subunit alpha-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43741
-
Expression Region
1-272aa
-
AA Sequence
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
-
Molecular Weight
57.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRKAa2, a protein kinase belonging to the AMP-activated protein kinase (AMPK) family, has garnered significant attention in recent years due to its critical role in cellular energy homeostasis and metabolic regulation. As a central player in detecting changes in cellular energy levels, PRKAa2 is activated in response to increases in AMP or decreases in ATP, facilitating various downstream signaling pathways involved in energy production, glucose uptake, and lipid metabolism. Dysregulation of PRKAa2 signaling has been implicated in various metabolic disorders, including obesity, type 2 diabetes, and cardiovascular diseases. Recent studies suggest that modulating PRKAa2 activity could hold therapeutic potential for these conditions. The development of recombinant PRKAa2 proteins offers a unique opportunity to explore the biochemical properties and functional mechanisms of this kinase in detail. By producing and characterizing PRKAa2 in vitro, researchers can investigate its role in cellular signaling pathways, identify potential substrates, and assess the effects of pharmacological agents on its activity. Furthermore, the recombinant protein can be employed in structure-function studies to elucidate the molecular mechanisms underlying its regulation. Understanding PRKAa2's function may pave the way for novel therapeutic strategies targeting metabolic diseases, highlighting the importance of continued research in this area.
