Analytical Data
-
Gene name
NABP1
- Application
-
Alternative Names
NABP1;OBFC2A;SSB2;SOSS complex subunit B2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96AH0
-
Expression Region
1-204aa
-
AA Sequence
MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NABP1 (Nucleic Acid Binding Protein 1) is a crucial protein involved in various biological processes, including nucleic acid metabolism and cellular stress responses. Its importance has garnered attention in the context of cancer research, as altered levels of NABP1 expression have been linked to tumor progression and metastasis. Recent studies have highlighted the role of NABP1 in modulating the activity of oncogenes and tumor suppressor genes, suggesting that it could serve as a potential biomarker for cancer diagnosis or prognosis. Understanding the structural and functional characteristics of NABP1 through recombinant protein technology is vital for elucidating its mechanisms of action. The production of recombinant NABP1 protein allows for in-depth biochemical analyses, including studies on its binding affinities and interactions with nucleic acids. Furthermore, exploring post-translational modifications of NABP1 can provide insights into its regulatory mechanisms. Given its significance in cellular homeostasis and disease states, the study of NABP1 through recombinant protein techniques represents a promising approach to uncover new therapeutic targets and strategies for cancer treatment.
