Analytical Data
-
Gene name
mbnA
- Application
-
Alternative Names
mbnA；Methanobactin mb-OB3b
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
E3YBA4
-
Expression Region
1-30aa
-
AA Sequence
MTVKIAQKKVLPVIGRAAALCGSCYPCSCM
-
Molecular Weight
3.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
mbnA is a protein derived from the "M. bovis" bacterium, known for its role in immunological responses. Research into mbnA recombinant proteins has gained traction due to their potential applications in vaccine development and immunotherapy. In the context of rising infectious diseases and antibiotic resistance, understanding mbnA can provide insights into novel therapeutic strategies. The ability to produce mbnA in recombinant forms allows for detailed studies of its structure and function, enabling scientists to explore its interactions with immune cells. This research is critical for the development of effective vaccines, especially against pathogens where traditional approaches have failed. Furthermore, by elucidating the mechanisms through which mbnA enhances immune responses, researchers aim to leverage its properties to boost vaccine efficacy and improve outcomes in infected individuals. Overall, the study of mbnA recombinant proteins is a promising frontier in the field of microbiology and immunology, with the potential to significantly advance public health initiatives.
