Analytical Data
-
Gene name
NAA50
- Application
-
Alternative Names
NAA50;MAK3;NAT13;NAT5;N-alpha-acetyltransferase 50
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZZ1
-
Expression Region
1-169aa
-
AA Sequence
MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN
-
Molecular Weight
46.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NAA50, or N-alpha acetyltransferase 50, is an enzyme that plays a crucial role in the protein acetylation process, which is vital for various cellular functions, including gene expression, protein stability, and signal transduction. The increasing interest in post-translational modifications has highlighted the importance of NAA50 in regulating protein function and its potential involvement in various diseases, including cancer and neurodegenerative disorders. Understanding the structure and function of NAA50 is essential for deciphering its biological roles and therapeutic implications. Recent studies have focused on the recombinant expression of NAA50 to facilitate functional analyses and structural characterization of the protein. This research aims to elucidate the enzyme's catalytic mechanisms and interaction partners, paving the way for the development of novel inhibitors or modulators that could have significant implications in treating diseases linked to dysregulated acetylation. Furthermore, investigating its evolutionary conservation and distribution across different organisms can provide insights into its biological significance and highlight potential applications in biotechnology and medicine. Overall, the study of recombinantly expressed NAA50 is a promising avenue for advancing our understanding of post-translational modifications and their impact on cellular homeostasis and disease states.
