Analytical Data
-
Gene name
LHFPL4
- Application
-
Alternative Names
LHFPL4; GARLH4; LHFPL tetraspan subfamily member 4 protein; GABAA receptor regulatory Lhfpl4; Lipoma HMGIC fusion partner-like 4 protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z7J7
-
Expression Region
1-247aa
-
AA Sequence
MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFGLFHYCVGSGLAGRELTCRGSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFSLFFFCNTATVYKICAWMQLLAALCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILAIIGILNALILSFLAFVLGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQGP
-
Molecular Weight
53.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LHFPL4 (LHFPL family member 4) is a member of the LHFPL protein family, which has garnered attention for its role in neurogenesis and synaptic function. Research indicates that LHFPL4 is predominantly expressed in the brain, particularly in neurons, suggesting a significant role in neural development and signaling. Studies have linked LHFPL4 to various neurological processes, including synaptic plasticity, which is crucial for learning and memory. Mutations or dysregulation of this protein have been implicated in certain neurodevelopmental disorders, prompting investigations into its functional mechanisms and potential therapeutic targets. The recombinant LHFPL4 protein serves as a vital tool for elucidating its molecular interactions and biological roles. By producing LHFPL4 in a recombinant form, researchers can study its structure, functional dynamics, and interactions with other proteins, providing crucial insights into its contributions to neuronal health and disease. Furthermore, understanding LHFPL4's mechanisms can pave the way for the development of novel interventions for neurological conditions associated with its dysfunction.
