Cat: PA2000-544DB

Recombinant Human FceRI Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FceRI

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FceRI;FCE1A;High affinity immunoglobulin epsilon receptor subunit alpha

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P12319

  • Expression Region

    1-257aa

  • AA Sequence

    MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLT CNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNE SEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGE ALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPRE KYWLQFFIPLLVVILFAVDTGLFISTQQQVTFLLKIKRTRKGFRLLNPHP KPNPKNN

  • Molecular Weight

    54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on FcεRI (high-affinity IgE receptor) recombinant proteins has gained significant attention in immunology and allergy studies due to the critical role this receptor plays in allergic responses. FcεRI is primarily expressed on immune cells such as mast cells and basophils and is responsible for binding to IgE antibodies. When allergens cross-link the receptor-bound IgE, it triggers a series of cellular activation events, leading to the release of mediators like histamine, cytokines, and leukotrienes, which contribute to allergy symptoms and anaphylaxis. Understanding the structure and function of FcεRI is paramount for developing targeted therapies for allergic diseases, including asthma, allergic rhinitis, and food allergies. The use of recombinant proteins allows for detailed biochemical characterization and structural analysis, facilitating the delineation of receptor-ligand interactions and signaling pathways. Moreover, these recombinant proteins serve as valuable tools for vaccine development, therapeutic interventions, and diagnostic assays. By producing FcεRI in heterologous systems, researchers can study its properties in a controlled environment, leading to advancements in allergen immunotherapy and novel treatment approaches aimed at modulating the immune response to reduce the severity of allergic reactions. Thus, the investigation of FcεRI recombinant proteins holds promise for enhancing our understanding of IgE-mediated mechanisms and improving clinical outcomes for patients suffering from allergic conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US