Cat: PA2000-8887

Recombinant Human LGR7 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LGR7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RXFP1; LGR7; Relaxin receptor 1; Leucine-rich repeat-containing G-protein coupled receptor 7; Relaxin family peptide receptor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HBX9

  • Expression Region

    68-162aa

  • AA Sequence

    WSMQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRAVPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKI

  • Molecular Weight

    36.19 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LGR7, or Leucine-rich repeat-containing G protein-coupled receptor 7, is a member of the leucine-rich repeat GPCR family, which plays a significant role in various biological processes including cell signaling, development, and metabolism. Recent studies have highlighted its involvement in reproductive functions and hormonal regulation, particularly in the context of the luteinizing hormone signaling pathway. Research on LGR7 is gaining momentum due to its potential implications in fertility treatments and endocrine disorders. The understanding of LGR7's structure, function, and downstream signaling mechanisms could provide new insights into therapeutic targets for conditions such as polycystic ovary syndrome (PCOS) and other reproductive health issues. Additionally, the development of recombinant LGR7 proteins is crucial for elucidating its biological functions, enabling high-throughput screening of ligands, and further exploring its role within the GPCR family. This line of research not only enhances our fundamental understanding of GPCR biology but also opens avenues for novel drug discovery and development, making LGR7 a promising candidate for future biomedical applications. As research progresses, the characterization of LGR7, through techniques such as X-ray crystallography and cryo-electron microscopy, will facilitate the design of specific modulators that could lead to improved clinical outcomes in related health conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US