Analytical Data
-
Gene name
MYCBP
- Application
-
Alternative Names
MYCBP;AMY1;c-Myc-binding Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99417
-
Expression Region
2-103aa
-
AA Sequence
AHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
-
Molecular Weight
27.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MYCBP, or MYC-binding protein, is a critical regulatory protein that has garnered attention in cancer research due to its role in oncogenic signaling pathways. MYC is a well-known transcription factor implicated in cell proliferation, growth, and metabolism, and it is often overexpressed in various cancers. The interaction between MYCBP and MYC suggests the former may play a significant role in modulating MYC's activity, influencing tumorigenesis and cancer progression. Understanding the structure and function of MYCBP can provide insights into its mechanism of action and potential as a therapeutic target. Recent studies have highlighted that the overexpression of MYCBP can lead to enhanced MYC activity, thereby promoting cancer cell survival and proliferation. Investigating MYCBP as a restructured protein offers the possibility of developing targeted therapies that disrupt its interaction with MYC, providing a novel approach for cancer treatment. The emphasis on creating recombinant forms of MYCBP has paved the way for detailed structural analysis and functional assays, ultimately contributing to the development of small molecules or antibodies that could inhibit MYCBP's role in cancer progression. Thus, the study of MYCBP is pivotal in unveiling new paradigms in cancer biology and developing effective interventions against MYC-driven tumors.
