Analytical Data
-
Gene name
DEP1
- Application
-
Alternative Names
DEP1；DEPDC1A；DEP domain-containing Protein 1A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12913
-
Expression Region
997-1337aa
-
AA Sequence
RKKRKDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFGKTNGYIA
-
Molecular Weight
65 Kda
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DEP1, also known as Protein Tyrosine Phosphatase 1B (PTP1B), is a pivotal protein involved in various cellular processes, particularly in the context of cancer biology and metabolic regulation. It plays a crucial role in the modulation of insulin signaling and the regulation of glucose homeostasis, making it a significant target for therapeutic intervention in metabolic disorders, such as type 2 diabetes and obesity. Research has shown that DEP1 is not only implicated in insulin receptor signaling but also in the modulation of other receptor tyrosine kinases, influencing cell proliferation, differentiation, and apoptosis. As a member of the protein tyrosine phosphatase family, DEP1 works by dephosphorylating tyrosine residues on substrate proteins, thus critically regulating signal transduction pathways. Given its involvement in tumorigenesis and the development of resistance to various cancer therapies, the understanding of DEP1's structural and functional characteristics through the study of recombinant DEP1 proteins has become increasingly important. This research enables the exploration of potential inhibitors and the elucidation of its role in disease mechanisms, opening avenues for novel therapeutic strategies. The study of DEP1, therefore, not only addresses fundamental biological questions but also holds promise for advancing clinical applications in treating metabolic diseases and cancers.
