Cat: PA1000-1961

Recombinant Human MGP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MGP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MGP;MGLAP;Matrix Gla Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P08493

  • Expression Region

    20-96aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMYESHESMESYELNPFINRRNANTFISPQQ RWRAKVQERIRERSKPVHELNREACDDYRLCERYAMVYGYNAAYNRYF

  • Molecular Weight

    12 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MGP (Matrix Gla Protein) is a vitamin K-dependent protein that plays a crucial role in the regulation of vascular calcification and bone metabolism. Its involvement in these biological processes has drawn significant attention in recent years, especially in the context of cardiovascular diseases, osteoporosis, and other age-related conditions. The intricate structure of MGP, featuring a high content of gamma-carboxy glutamic acid residues, allows it to bind calcium ions effectively, thereby preventing excessive mineralization in soft tissues. Research has revealed that MGP may exert protective effects against arterial stiffness and has potential implications for therapeutic strategies aimed at treating or preventing vascular-related pathologies. Moreover, MGP's expression levels have been associated with various disease states, making it a potential biomarker for assessing cardiovascular risk. In light of these findings, the recombinant production of MGP has emerged as a significant area of study, enabling researchers to investigate its functional properties, develop potential therapeutic agents, and explore its role in disease modulation. The ongoing exploration of MGP's structure-function relationships and its implications in health and disease underscores its importance in biomedical research and offers promising avenues for future therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US