Analytical Data
-
Gene name
MGP
- Application
-
Alternative Names
MGP;MGLAP;Matrix Gla Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08493
-
Expression Region
20-96aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMYESHESMESYELNPFINRRNANTFISPQQ RWRAKVQERIRERSKPVHELNREACDDYRLCERYAMVYGYNAAYNRYF
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MGP (Matrix Gla Protein) is a vitamin K-dependent protein that plays a crucial role in the regulation of vascular calcification and bone metabolism. Its involvement in these biological processes has drawn significant attention in recent years, especially in the context of cardiovascular diseases, osteoporosis, and other age-related conditions. The intricate structure of MGP, featuring a high content of gamma-carboxy glutamic acid residues, allows it to bind calcium ions effectively, thereby preventing excessive mineralization in soft tissues. Research has revealed that MGP may exert protective effects against arterial stiffness and has potential implications for therapeutic strategies aimed at treating or preventing vascular-related pathologies. Moreover, MGP's expression levels have been associated with various disease states, making it a potential biomarker for assessing cardiovascular risk. In light of these findings, the recombinant production of MGP has emerged as a significant area of study, enabling researchers to investigate its functional properties, develop potential therapeutic agents, and explore its role in disease modulation. The ongoing exploration of MGP's structure-function relationships and its implications in health and disease underscores its importance in biomedical research and offers promising avenues for future therapeutic interventions.
