Analytical Data
-
Gene name
KRTAP5-11
- Application
-
Alternative Names
KRTAP5-11; KAP5.11; KRTAP5.11Keratin-associated protein 5-11; Keratin-associated protein 5.11; Ultrahigh sulfur keratin-associated protein 5.11
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6L8G4
-
Expression Region
1-156aa
-
AA Sequence
MGCCGCSGGCGSGCGGCGSGSGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSSCGSCGGSKGGCGSCGSSKGGCGSCGCSQSNCCKPCCSSSGCGSFCCQSSCSKPCCCQSSCCQSSCCKPCCCQSSCCQSSCFKPCCCQSSCCVPVCCQCKI
-
Molecular Weight
43.56 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KRTAP5-11, a member of the keratin-associated protein (KRTAP) family, plays a crucial role in the structural integrity and mechanical properties of hair and wool. These proteins are essential for the formation of the hair follicle matrix and are significantly involved in the regulation of hair fiber characteristics, such as strength and elasticity. Due to its specific expression in the hair follicle, KRTAP5-11 has garnered attention in the fields of dermatology and trichology, particularly in understanding hair disorders and defects. Research into recombinant KRTAP5-11 protein has focused on elucidating its functional roles, interactions with other keratin proteins, and potential applications in cosmetic and therapeutic products aimed at enhancing hair quality. Additionally, studies have been conducted to explore genetic variations in KRTAP5-11 that may contribute to phenotypic differences in hair types across various breeds, which is significant for both agricultural practices and human hair biology. This protein not only provides insights into fundamental biological processes but also presents opportunities for innovative solutions in the treatment of hair-related abnormalities and conditions.
