Analytical Data
-
Gene name
SLC39A11
- Application
-
Alternative Names
SLC39A11；C17orf26；ZIP11；Zinc transporter ZIP11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N1S5
-
Expression Region
93-193aa
-
AA Sequence
YLADLLMPHLGAAEDPQTTLALNFGSTLMKKKSDPEGPALLFPESELSIRIGRAGLLSDKSENGEAYQRKKAAATGLPEGPAVPVPSRGNLAQPGGSSWRR
-
Molecular Weight
42.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The SLC39A11 gene, part of the SLC39 family of metal ion transporters, encodes a protein that plays a crucial role in zinc homeostasis and cellular function. Zinc is an essential trace element involved in various biological processes, including enzyme function, signal transduction, and gene expression. Mutations or dysregulation of SLC39A11 have been implicated in several diseases, including neurological disorders and certain cancers, highlighting the importance of this transporter in health and disease. Research on SLC39A11, particularly its recombinant protein, aims to elucidate its structure-function relationships and regulatory mechanisms. By producing and characterizing this protein, scientists seek to understand its transport properties, identify potential interacting partners, and explore its role in cellular zinc uptake and metabolic pathways. This knowledge could pave the way for developing therapeutic strategies targeting SLC39A11-related conditions and advancing our understanding of zinc's role in human health.
