Analytical Data
-
Gene name
DPYSL4
- Application
-
Alternative Names
DPYSL4；CRMP3；ULIP4；Dihydropyrimidinase-related Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14531
-
Expression Region
280-560aa
-
AA Sequence
TASLGTDGSHYWSKNWAKAAAFVTSPPVNPDPTTADHLTCLLSSGDLQVTGSAHCTFTTAQKAVGKDNFALIPEGTNGIEERMSMVWEKCVASGKMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVIWNPKATKIISAKTHNLNVEYNIFEGVECRGAPAVVISQGRVALEDGKMFVTPGAGRFVPRKTFPDFVYKRIKARNRLAEIHGVPRGVYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIMA
-
Molecular Weight
66.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DPYSL4, a member of the collapsin response mediator protein (CRMP) family, plays a critical role in neural development and axon guidance. Functioning as a signaling molecule, DPYSL4 is implicated in various cellular processes, including cytoskeletal dynamics, cell migration, and neuronal differentiation. Recent studies have highlighted its involvement in neurodegenerative diseases, cancer progression, and the modulation of synaptic plasticity. Due to its multifunctional roles and expression in the brain, the investigation of DPYSL4 recombinant proteins has become increasingly important. Researchers aim to elucidate its molecular mechanisms, explore its potential as a therapeutic target, and understand its contribution to pathological conditions. The recombinant expression of DPYSL4 facilitates the study of its structural properties, interaction with other proteins, and biological functions in vitro and in vivo. Understanding the intricate roles of DPYSL4 not only advances our knowledge of neurobiology but also opens avenues for developing novel therapeutic strategies for neurodegenerative diseases and other disorders associated with impaired neuronal function.
