Analytical Data
-
Gene name
MGLL
- Application
-
Alternative Names
MGLL;Monoglyceride lipase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99685
-
Expression Region
1-303aa
-
AA Sequence
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
-
Molecular Weight
60.3kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MGLL (Monoacylglycerol lipase) is a crucial enzyme involved in the endocannabinoid system, responsible for the hydrolysis of monoacylglycerols into glycerol and fatty acids. This enzyme plays a significant role in regulating lipid metabolism, as well as modulating neurotransmitter release and synaptic activity in the central nervous system. Recent research has highlighted the involvement of MGLL in various physiological processes and its potential implications in several pathological conditions, including obesity, pain, and neurodegenerative diseases. Given the therapeutic significance of controlling the endocannabinoid signaling pathways, the development of recombinant MGLL has gained attention. Studying the recombinant form of MGLL can provide invaluable insights into its function, structure, and interaction with inhibitors, paving the way for novel drug development targeting MGLL for therapeutic interventions. The ability to produce MGLL in a recombinant system also allows for large-scale production, facilitating high-throughput screening of potential inhibitors. Understanding the biochemical and biophysical properties of MGLL may lead to significant advancements in treating conditions associated with dysregulated endocannabinoid signaling, thus underscoring the enzyme's role as a promising target in pharmacology and drug design.











