Cat: PA2000-4708

Recombinant Human ALDH1B1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ALDH1B1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ALDH1B1;ALDH5;ALDHX;Aldehyde dehydrogenase X. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P30837

  • Expression Region

    Arg18~Ser517

  • AA Sequence

    RYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAEG DRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLASLETL DNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVC GQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPG VVNIITGYGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELG GKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVE KAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERG FFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVF TRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYT EVKTVTIKVPQKNS

  • Molecular Weight

    59.0kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Aldehyde dehydrogenase 1B1 (ALDH1B1) is an enzyme that belongs to the ALDH family, playing a crucial role in the metabolism of endogenous and exogenous aldehydes by converting them into corresponding carboxylic acids. This process is essential for cellular detoxification and maintaining redox balance within the cell. ALDH1B1 has garnered attention due to its involvement in various physiological and pathological processes, including stem cell differentiation, cancer progression, and metabolism of retinoids and other biologically active compounds. Research has revealed that alterations in ALDH1B1 expression and activity can have significant implications in diseases such as liver dysfunction, several types of cancer, and neurological disorders. Moreover, the recombinant protein form of ALDH1B1 is valuable for studying its biochemical properties, understanding the substrate specificity, and uncovering its role in different metabolic pathways. Advances in recombinant DNA technology have facilitated the expression and purification of ALDH1B1, enabling researchers to investigate its functional characteristics in vitro and in vivo. Such studies can provide insights into the enzyme's potential as a therapeutic target and biomarker for various diseases, paving the way for new strategies in disease management and personalized medicine. Overall, the research on recombinant ALDH1B1 protein holds promise for enhancing our understanding of its functional roles and therapeutic applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US