Analytical Data
-
Gene name
LIME1
- Application
-
Alternative Names
LIME1;LIME;Lck-interacting transmembrane adapter 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H400
-
Expression Region
1-295aa
-
AA Sequence
MGLPVSWAPPALWVLGCCALLLSLWALCTACRRPEDAVAPRKRARRQRARLQGSATAAEASLLRRTHLCSLSKSDTRLHELHRGPRSSRALRPASMDLLRPHWLEVSRDITGPQAAPSAFPHQELPRALPAAAATAGCAGLEATYSNVGLAALPGVSLAASPVVAEYARVQKRKGTHRSPQEPQQGKTEVTPAAQVDVLYSRVCKPKRRDPGPTTDPLDPKGQGAILALAGDLAYQTLPLRALDVDSGPLENVYESIRELGDPAGRSSTCGAGTPPASSCPSLGRGWRPLPASLP
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LIME1 (Lymphocyte-Specific Protein Tyrosine Kinase, member 1) is a member of the protein tyrosine kinase family and plays a pivotal role in lymphocyte signaling and immune responses. Research into LIME1 has gained momentum due to its involvement in various cellular processes, including T cell activation, differentiation, and the regulation of immune synapse formation. Dysregulation of LIME1 has been implicated in several pathological conditions, including autoimmunity and cancer, making it a potential therapeutic target. The recombinant expression of LIME1 protein allows for detailed structural and functional studies, enabling researchers to investigate its role in signaling pathways and interactions with other proteins. By producing LIME1 in a controlled laboratory setting, scientists can better understand its mechanisms of action and how it orchestrates immune responses. Additionally, the recombinant protein can be utilized in developing diagnostic tools and therapeutics aimed at modulating immune responses, highlighting its significance in both fundamental and applied immunology research. As a result, the study of LIME1 recombinant protein not only enhances our understanding of immune regulation but also paves the way for innovative approaches to treat immune-related diseases.
