Cat: PA2000-381DB

Recombinant Human 5-HT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    5-HT

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    5-HT;5-hydroxytryptamine receptor 5A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P47898

  • Expression Region

    1-357aa

  • AA Sequence

    MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFL VAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVH ELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYT LRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSY AVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKD SAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFK NFFSRQH

  • Molecular Weight

    65 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of 5-hydroxytryptamine (5-HT), commonly known as serotonin, has garnered significant attention in neuroscience and pharmacology due to its pivotal role as a neurotransmitter in regulating mood, emotion, and various physiological functions. Research into 5-HT reconstitution proteins focuses on understanding the molecular mechanisms of serotonin signaling and its implications in mental health disorders such as depression, anxiety, and schizophrenia. The production of recombinant 5-HT proteins allows for detailed investigation into the receptor interactions, binding affinities, and downstream signaling pathways that 5-HT engages in within the central nervous system. By expressing and purifying these proteins in a laboratory setting, researchers can explore the structural and functional properties of serotonin receptors, facilitating the development of targeted therapies aimed at modulating serotonin levels and improving mental health outcomes. Furthermore, this research contributes to the broader understanding of the serotonergic system, its biological significance, and its potential as a therapeutic target in treating a range of neurological and psychiatric conditions. Overall, the exploration of 5-HT reconstitution proteins represents a vital intersection of molecular biology, neuroscience, and pharmacology, with the promise of advancing our knowledge and treatment of serotonin-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US