Analytical Data
-
Gene name
UGT2B17
- Application
-
Alternative Names
UGT2B17;UDP-glucuronosyltransferase 2B17
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75795
-
Expression Region
24-530aa
-
AA Sequence
GKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD
-
Molecular Weight
64.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UGT2B17 is a member of the UDP-glucuronosyltransferase (UGT) family, which plays a crucial role in the metabolic processing and detoxification of various endogenous and exogenous compounds. Specifically, UGT2B17 is responsible for the glucuronidation of many steroid hormones and drugs, influencing their pharmacokinetics and pharmacodynamics. Variations in UGT2B17 gene expression can significantly impact individual responses to medications, leading to variations in drug efficacy and toxicity. Research has shown that this enzyme is involved in the metabolism of substances like testosterone and certain therapeutic agents, making it important in hormone regulation and drug metabolism. Understanding the structure and function of UGT2B17 is essential for pharmacogenomics, as genetic polymorphisms may contribute to interindividual variability in drug response. Furthermore, studying the recombinant protein form of UGT2B17 allows researchers to investigate the enzyme's catalytic properties and interactions with various substrates in vitro. This research can enhance our understanding of its role in drug metabolism and inform personalized medicine approaches, particularly in the context of optimizing drug therapy and minimizing adverse effects in patients. The production and characterization of recombinant UGT2B17 serve as pivotal steps toward elucidating the enzyme's functional dynamics and its potential implications in clinical settings.











