Analytical Data
-
Gene name
SINHCAF
- Application
-
Alternative Names
SINHCAF；C12orf14；FAM60A；SIN3-HDAC complex-associated factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NP50
-
Expression Region
1-221aa
-
AA Sequence
MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW
-
Molecular Weight
51.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SINHCAF, or SIN3 interaction protein C-terminal domain associated factor, is a critical component in the regulation of gene expression and chromatin remodeling. Recent studies highlight its role in cellular processes such as differentiation, proliferation, and apoptosis. The protein interacts with the SIN3 complex, which is well-known for its involvement in transcriptional repression and maintenance of epigenetic states. Understanding the function and mechanisms of SINHCAF is essential for unraveling the complexities of these biological processes. Moreover, dysregulation of SINHCAF has been implicated in various diseases, including cancer, where abnormal gene expression contributes to tumorigenesis. Researchers are increasingly focused on characterizing the structural and functional aspects of SINHCAF, utilizing techniques such as X-ray crystallography and cryo-electron microscopy to investigate its interactions at the molecular level. The findings from these studies could provide valuable insights into potential therapeutic targets and innovative strategies for disease intervention, underscoring the importance of SINHCAF in both fundamental biology and clinical applications.
