Cat: PA1000-1676

Recombinant Human IP6K2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IP6K2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IP6K2;IHPK2;Inositol hexakisphosphate kinase 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UHH9

  • Expression Region

    1-426aa

  • AA Sequence

    MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQ FYETLPAEMRKFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVD NSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEKMKSHKLEEEF EWLKKSEVLYYTVEKKGNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQ YKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSA VIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLR RELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE DLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHE GQDAGYIFGLQSLIDIVTEISEESGEHHHHHHGGGLNDIFEAQKIEWHE

  • Molecular Weight

    52 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IP6K2 (inositol hexakisphosphate kinase 2) is a pivotal enzyme in the phosphoinositide signaling pathway, playing an essential role in cellular processes such as proliferation, differentiation, and apoptosis. It is involved in the phosphorylation of inositol hexakisphosphate (IP6) into inositol pyrophosphates, which are critical for various cellular functions, including energy metabolism and cell signaling. Recent studies have revealed that IP6K2 is not only important for cellular homeostasis but also participates in the regulation of stress responses and tumorigenesis. Dysregulation of IP6K2 has been implicated in several diseases, including cancer, where altered signaling pathways contribute to uncontrolled cell growth. Consequently, IP6K2 has emerged as a potential therapeutic target, making the understanding of its structure and function increasingly important. Research into recombinant forms of IP6K2 allows for the exploration of its enzymatic activity and interaction with other cellular components. This research can aid in developing small molecule inhibitors or activators that could modulate IP6K2 activity for therapeutic purposes. Investigating the molecular mechanisms of IP6K2 will enhance our understanding of its role in health and disease, potentially leading to novel treatment strategies for cancer and other related conditions. Overall, the study of recombinant IP6K2 not only sheds light on its biological significance but also paves the way for innovative approaches in drug development targeting this key enzyme.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US