Cat: PA2000-4473

Recombinant Human GPD1L Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GPD1L

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GPD1L;KIAA0089;Glycerol-3-phosphate dehydrogenase 1-like Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N335

  • Expression Region

    1-351aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAAAPLKVCIVGSGNWGSAVAKIIGNNVKK LQKFASTVKMWVFEETVNGRKLTDIINNDHENVKYLPGHKLPENVVAMSN LSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGIDEGPEG LKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLLFK ELLQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVI RLGLMEMIAFARIFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFA RTGKTIEELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQI CYESRPVQEMLSCLQSHPEHT

  • Molecular Weight

    41 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GPD1L, or glycerol-3-phosphate dehydrogenase 1-like protein, has garnered significant attention in recent years due to its critical role in cellular metabolism and its implications in various health conditions. Functioning primarily in the glycerol phosphate shuttle, GPD1L is integral in mitochondrial function and energy production, particularly in tissues with high energy demands, such as the heart and skeletal muscle. Mutations in the GPD1L gene have been implicated in inherited cardiac disorders, including arrhythmogenic right ventricular cardiomyopathy and familial dilated cardiomyopathy, highlighting its potential as a biomarker for cardiovascular diseases. Research into GPD1L has expanded beyond basic metabolic studies to include its involvement in oxidative stress response and lipid metabolism, suggesting a multifaceted role in both health and disease. As such, recombinant GPD1L proteins have been developed for various experimental applications, offering insights into its enzymatic activity and substrate interactions. The study of GPD1L not only enhances our understanding of metabolic diseases but also paves the way for potential therapeutic strategies aimed at modulating its activity in the context of cardiac dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US