Analytical Data
-
Gene name
SPARC
- Application
-
Alternative Names
SPARC;ON;SPARC
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09486
-
Expression Region
18-303aa
-
AA Sequence
APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
-
Molecular Weight
59.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPARC, or Secreted Protein Acidic and Rich in Cysteine, is a matricellular protein that plays a critical role in various biological processes, including cell adhesion, migration, and proliferation. Its involvement in the extracellular matrix (ECM) makes SPARC significant in tissue repair and remodeling, particularly in the context of cancer and fibrosis. Research on SPARC has highlighted its dual role in tumor progression and suppression, as it can influence the tumor microenvironment and interact with multiple signaling pathways. The study of SPARC recombinant proteins is pivotal for understanding its structure-function relationships, as well as its interactions with other ECM components and cell surface receptors. Producing SPARC in a recombinant form allows for detailed biochemical and biophysical characterization, enabling researchers to unravel its roles in normal physiology and pathological conditions. Furthermore, SPARC's potential as a therapeutic target is gaining attention, with investigations focusing on its modulation in various diseases, including cancer and cardiovascular disorders. Thus, the ongoing study of SPARC and its recombinant proteins holds great promise for therapeutic advancements and insights into ECM biology.











