Cat: PA2000-317DB

Recombinant Human TCN1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TCN1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TCN1;TC1;Transcobalamin-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P20061

  • Expression Region

    24-433aa

  • AA Sequence

    EICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQTLMQ KMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLE NKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPE NKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKS LVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVL TEISQGAFSNPNAAAQVLPALMGKTFLDINKDSSCVSASGNFNISADEPI TVTPPDSQSYISVNYSVRINETYFTNVTVLNGSVFLSVMEKAQKMNDTIF GFTMEERSWGPYITCIQGLCANNNDRTYWELLSGGEPLSQGAGSYVVRNG ENLEVRWSKY

  • Molecular Weight

    62 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TCN1 (Tetratricopeptide Repeat Protein 1) is a protein that has garnered attention in the field of molecular biology and biochemistry due to its unique structural motifs and potential functional roles. As a member of the tetratricopeptide repeat (TPR) family, TCN1 is characterized by a repetitive sequence that facilitates protein-protein interactions, which are critical in various cellular processes including transcription regulation, protein folding, and signaling pathways. The study of TCN1 recombinant protein has been motivated by its involvement in essential biological functions and its potential implications in disease mechanisms, particularly in cancers and neurodegenerative disorders. By producing recombinant TCN1, researchers aim to elucidate its biochemical properties, optimal folding conditions, and interactions with other proteins, thereby contributing valuable insights into its functional roles in the cell. Additionally, understanding the dynamics of TCN1 may pave the way for the development of therapeutic strategies targeting its pathways. The ongoing research into TCN1's structure and function reinforces the importance of this protein in both basic and applied sciences, highlighting its potential as a biomarker and as a therapeutic target for various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US