Analytical Data
-
Gene name
CHRNa5
- Application
-
Alternative Names
CHRNa5;NACHRA5;Neuronal acetylcholine receptor subunit alpha-5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30532
-
Expression Region
38-131aa
-
AA Sequence
SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVD EKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cholinergic receptors, particularly the nicotinic acetylcholine receptors (nAChRs), play a critical role in neurotransmission and have been implicated in various neurological disorders. Among these receptors, the alpha-5 subunit (CHRNa5) has garnered attention due to its involvement in modulating nicotinic receptor activity and its potential association with conditions such as nicotine addiction, schizophrenia, and cognitive deficits. Research indicates that variations in the CHRNa5 gene can influence the risk of developing these disorders, making it a focus of genetic and pharmacological studies. The expression of CHRNa5 as a recombinant protein enables researchers to explore its functional properties and interactions within the receptor complex. By studying the recombinant CHRNa5 protein, scientists aim to elucidate its role in receptor assembly and function, paving the way for targeted therapeutic strategies that could address the underlying mechanisms of diseases associated with cholinergic dysregulation. This line of research not only enhances our understanding of the molecular basis of nAChRs but also contributes to the development of novel interventions for nicotine-related disorders and cognitive impairments.











