Analytical Data
-
Gene name
nsp3
- Application
-
Alternative Names
nsp3；EIF4F；EIF4G；EIF4GI；Eukaryotic translation initiation factor 4 gamma 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O04318
-
Expression Region
1-467aa
-
AA Sequence
MAQKLVAQGGETGDVWDDGVYDNVTKVYVGQGQYGIAFVKFEYANGSEVVVGDEHGEKTELGVEEFEIDSDDYIVYVEGYREKVSDMTSEMITFLSFKTSKGKTSQPIVKKPGVKFVLHGGKIVGFHGRSTDVLHSLGAYVSLPSTPKLLGNWIKVEQNGEGPGLRCSHGIAQVGNKIYSFGGELIPNQPIDKHLYVFDLETRTWSIAPATGDVPHLSCLGVRMVSVGSTLYTFGGRDFSRQYNGFYSFDTTTNEWKLLTPVEEGPTPRSFHSMAADEENVYVFGGVGAMDRIKTLDSYNIVDKTWFHCSNPGDSFSIRGGAGLEVVQGKVWIVYGFNGCEVDDVHFYDPAEDKWTQVETFGVKPNERSVFASAAIGKHIVIFGGEIAMDPRAHVGPGQLIDGTFALDTETLQWERLDKFEGTPSSRGWTASTTGTIDGKKGLVMHGGKAPTNDRFDDLFFYGIDSV
-
Molecular Weight
51.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NSP3 (non-structural protein 3) is a pivotal protein found in various positive-sense RNA viruses, including coronaviruses and several other viral families. It plays a crucial role in the viral life cycle, participating in processes such as replication and immune evasion. NSP3 is known for its multifunctionality, harboring several domains that facilitate interactions with host cell proteins, aiding in viral pathogenesis. The recent global attention brought by the COVID-19 pandemic has spurred extensive research into NSP3, particularly its structure and function, as it represents a potential target for antiviral drug development. Understanding NSP3’s interactions with host factors not only sheds light on the mechanisms of viral replication and host cell modulation but also offers insights into the development of therapeutic strategies. Researchers are employing various techniques, including crystallography and cryo-electron microscopy, to elucidate the protein's structure and functional motifs. This knowledge is crucial for devising inhibitors that could disrupt NSP3's activities, potentially leading to effective treatments against infections caused by NSP3-expressing viruses. Consequently, NSP3 continues to be a prominent focus of virology research, aiming to unravel its complexities and exploit them for therapeutic gains.
