Cat: PA1000-1527

Recombinant Human HSPB11 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HSPB11

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IFT25;C1orf41;HSPB11;Intraflagellar transport Protein 25 homolog

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y547

  • Expression Region

    1-144aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMRKIDLCLSSEGSEVILATSSDEKHPPENI IDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSK EPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVH SVSAEGTVVSNLSS

  • Molecular Weight

    19 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HSPB11, a member of the small heat shock protein (sHSP) family, has garnered significant attention in recent years due to its potential roles in cellular stress responses and neuroprotection. Research indicates that HSPB11 is involved in various critical biological processes, including protein folding, aggregation prevention, and apoptosis regulation. Its expression is often upregulated in response to thermal stress, oxidative stress, and other cellular insults, suggesting a protective function in maintaining cellular homeostasis. Furthermore, studies have linked HSPB11 to neurodegenerative diseases such as amyotrophic lateral sclerosis (ALS) and Alzheimer's disease, where it may contribute to the mitigation of toxic protein aggregation. The recombinant production of HSPB11 allows for detailed biochemical studies and offers insights into its structural properties and functional mechanisms. By exploring HSPB11 through recombinant protein techniques, researchers aim to elucidate its role in cellular stress response pathways and its potential as a therapeutic target. Understanding HSPB11's molecular interactions and cellular roles could pave the way for novel approaches in treating diseases characterized by protein misfolding and aggregation. Overall, further investigation into HSPB11 not only enhances our comprehension of protein homeostasis but also holds promise for developing therapeutic strategies for associated neurodegenerative conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US