Analytical Data
-
Gene name
HS3ST2
- Application
-
Alternative Names
HS3ST2; 3OST2; UNQ2442/PRO5004Heparan sulfate glucosamine 3-O-sulfotransferase 2; EC 2.8.2.29; Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2; 3-OST-2; Heparan sulfate 3-O-sulfotransferase 2; h3-OST-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y278
-
Expression Region
1-367aa
-
AA Sequence
MAYRVLGRAGPPQPRRARRLLFAFTLSLSCTYLCYSFLCCCDDLGRSRLLGAPRCLRGPSAGGQKLLQKSRPCDPSGPTPSEPSAPSAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRVHPDVRALGTEPHFFDRNYGRGLDWYRSLMPRTLESQITLEKTPSYFVTQEAPRRIFNMSRDTKLIVVVRNPVTRAISDYTQTLSKKPDIPTFEGLSFRNRTLGLVDVSWNAIRIGMYVLHLESWLQYFPLAQIHFVSGERLITDPAGEMGRVQDFLGIKRFITDKHFYFNKTKGFPCLKKTESSLLPRCLGKSKGRTHVQIDPEVIDQLREFYRPYNIKFYETVGQDFRWE
-
Molecular Weight
41.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HS3ST2 (heparan sulfate 3-O-sulfotransferase 2) is an important enzyme involved in the biosynthesis of heparan sulfate, a polysaccharide that plays critical roles in various biological processes, including cell signaling, development, and tissue homeostasis. Research has shown that HS3ST2 is responsible for the specific sulfation of heparan sulfate chains, which modulates their interaction with a wide range of growth factors, cytokines, and extracellular matrix components. This enzymatic activity is particularly significant in regulating key signaling pathways, such as those involving fibroblast growth factor (FGF) and hepatocyte growth factor (HGF), which are essential for processes like angiogenesis and cell proliferation. Dysregulation of HS3ST2 has been implicated in various pathological conditions, including cancer, where altered heparan sulfate sulfation patterns can affect tumor growth and metastasis. Recent studies have focused on the recombinant production and characterization of HS3ST2 to better understand its functional roles and potential as a therapeutic target. By producing HS3ST2 as a recombinant protein, researchers aim to investigate its structural properties, enzymatic activity, and interactions with heparan sulfate substrates, paving the way for innovative approaches to manipulate heparan sulfate biology in disease contexts. This research not only enhances our understanding of HS3ST2's function but also opens avenues for the development of novel strategies in regenerative medicine and cancer therapy, underscoring the importance of this enzyme in both health and disease.
