Analytical Data
-
Gene name
Ilp7
- Application
-
Alternative Names
Ilp7；Probable insulin-like peptide 7
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9W4Q9
-
Expression Region
32-159aa
-
AA Sequence
LQHTEEGLEMLFRERSQSDWENVWHQETHSRCRDKLVRQLYWACEKDIYRLTRRNKKRTGNDEAWIKKTTTEPDGSTWLHVNYANMFLRSRRSDGNTPSISNECCTKAGCTWEEYAEYCPSNKRRNHY
-
Molecular Weight
19.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ILP7, a member of the interleukin-1 (IL-1) family, has garnered attention due to its significant role in inflammation and immune responses. As a type of interleukin, ILP7 is believed to modulate various biological processes, including cell proliferation, differentiation, and apoptosis. Researchers have shown that ILP7 may be involved in a range of diseases, including autoimmune disorders and certain cancers, by influencing signaling pathways that regulate inflammatory responses. The investigation into ILP7 recombinant proteins aims to harness their functional properties for therapeutic applications and to understand their mechanistic roles in health and disease better. Recombinant expression systems provide a platform for producing ILP7 in sufficient quantities for detailed studies. Understanding the structure-function relationships of ILP7 can lead to the development of novel drugs that target specific pathways in inflammatory diseases. Additionally, studying ILP7 could provide insights into potential biomarkers for disease diagnosis and prognosis. The growing body of research underscores the importance of ILP7 in immunology and its potential as a target for innovative clinical interventions. As such, the recombinant production of ILP7 proteins is a crucial step in elucidating their biological significance and therapeutic potential.
