Analytical Data
-
Gene name
CBLIF
- Application
-
Alternative Names
CBLIF；GIF；IFMH；Cobalamin binding intrinsic factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P27352
-
Expression Region
19-417aa
-
AA Sequence
STQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
-
Molecular Weight
45.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CBLIF, or CB1-Like Interacting Factor, is a protein that has garnered attention for its potential roles in various physiological processes, including the modulation of immune responses and neuroprotection. The study of CBLIF has emerged from an increasing interest in understanding the interactions between cannabinoid receptors and their ligands, particularly in the context of their involvement in signal transduction pathways. Research indicates that CBLIF may play a crucial role in mediating the effects of cannabinoids, which are compounds found in cannabis that interact with the endocannabinoid system. As scientists explore the therapeutic potential of cannabinoids for treating a range of conditions—from chronic pain to neurodegenerative diseases—understanding the mechanisms by which CBLIF functions could unlock new avenues for drug development. Moreover, the recombinant production of CBLIF enables researchers to investigate its structure-function relationships and perform functional assays to define its role in cellular signaling. As such, the recombinant study of CBLIF is positioned at the intersection of molecular biology, pharmacology, and therapeutic innovation, paving the way for novel approaches in the management of conditions influenced by cannabinoid signaling pathways. Understanding CBLIF’s biochemical properties and interactions not only enhances our grasp of the endocannabinoid system but also contributes to the broader field of biotechnology aimed at harnessing proteins for therapeutic use.
