Cat: PA1000-1384

Recombinant Human H3F3A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    H3F3A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    H3-3A;H3.3A;H3F3;H3F3A;Histone H3.3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P84243

  • Expression Region

    1-136aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMARTKQTARKSTGGKAPRKQLATKAAR KSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ DFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL ARRIRGERA

  • Molecular Weight

    18 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

H3F3A, a gene encoding the histone variant H3.3, plays a crucial role in various biological processes, including gene regulation, cellular differentiation, and the maintenance of genome stability. Unlike conventional histones, H3.3 is incorporated into chromatin regardless of cell division, making it essential for dynamic cellular contexts, especially during development and in response to environmental stimuli. The study of H3F3A is particularly significant due to its association with several human diseases, including various cancers, where mutations in this gene can lead to altered epigenetic landscapes and dysregulation of gene expression. Researchers have focused on characterizing the properties of recombinant H3.3 protein to better understand its role in chromatin remodeling and transcriptional regulation. Understanding how H3F3A reorganization affects chromatin dynamics and gene expression can provide insights into fundamental biological processes and aid in the development of targeted therapies for diseases linked to histone modifications. As such, H3F3A serves as a crucial model for studying the interplay between histone variants and their impact on cellular functions and disease mechanisms. Advances in technologies, including CRISPR/Cas9 gene editing and high-throughput sequencing, have further enhanced our ability to investigate the functional consequences of H3F3A alterations and their roles in the epigenetic modulation of gene activity.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US