Analytical Data
-
Gene name
H3F3A
- Application
-
Alternative Names
H3-3A;H3.3A;H3F3;H3F3A;Histone H3.3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P84243
-
Expression Region
1-136aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMARTKQTARKSTGGKAPRKQLATKAAR KSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ DFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQL ARRIRGERA
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
H3F3A, a gene encoding the histone variant H3.3, plays a crucial role in various biological processes, including gene regulation, cellular differentiation, and the maintenance of genome stability. Unlike conventional histones, H3.3 is incorporated into chromatin regardless of cell division, making it essential for dynamic cellular contexts, especially during development and in response to environmental stimuli. The study of H3F3A is particularly significant due to its association with several human diseases, including various cancers, where mutations in this gene can lead to altered epigenetic landscapes and dysregulation of gene expression. Researchers have focused on characterizing the properties of recombinant H3.3 protein to better understand its role in chromatin remodeling and transcriptional regulation. Understanding how H3F3A reorganization affects chromatin dynamics and gene expression can provide insights into fundamental biological processes and aid in the development of targeted therapies for diseases linked to histone modifications. As such, H3F3A serves as a crucial model for studying the interplay between histone variants and their impact on cellular functions and disease mechanisms. Advances in technologies, including CRISPR/Cas9 gene editing and high-throughput sequencing, have further enhanced our ability to investigate the functional consequences of H3F3A alterations and their roles in the epigenetic modulation of gene activity.











