Analytical Data
-
Gene name
HS1BP3
- Application
-
Alternative Names
ETM2; FLJ14249; H1BP3_HUMAN; HCLS1 binding protein 3; HCLS1-binding protein 3; HS1 binding protein 3; HS1 BP3; HS1-binding protein 3; Hs1bp3; HSP1BP-3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53T59
-
Expression Region
1-213aa
-
AA Sequence
MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEALDPLGIMRLVSCC
-
Molecular Weight
49.17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HS1BP3, or Hematopoietic Stem Cell 1-Binding Protein 3, is a member of the HS1 (Hematopoietic Cell-Specific Gene 1) family, which plays a crucial role in the regulation of hematopoietic stem cell function and differentiation. Recent studies have highlighted its potential involvement in various cellular processes, including cell signaling, apoptosis, and immune response modulation, making it a candidate for research in cancer and autoimmune diseases. The reorganization and functional analysis of HS1BP3 have garnered attention as researchers seek to elucidate its precise biological roles and therapeutic potential. Understanding the structural and functional characteristics of HS1BP3 could provide insights into its mechanism of action and its interactions with other cellular proteins. This growing interest is supported by the increasing prevalence of blood disorders and the need for targeted treatments that can modify stem cell behavior, leading to improved therapeutic strategies. Consequently, the study of HS1BP3 and its recombinant protein forms aims to explore novel approaches in regenerative medicine and cancer therapy, bridging the gap between basic research and clinical applications.











