Analytical Data
-
Gene name
H2AFZ
- Application
-
Alternative Names
H2AZ1;H2AFZ;H2AZ;Histone H2A.Z
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0C0S5
-
Expression Region
1-128aa
-
AA Sequence
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGAT AAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSL IKATIAGGGVIPHIHKSLIGKKGQQKTV
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
H2AFZ, a variant of the histone H2A protein, plays a crucial role in the regulation of gene expression and chromatin structure. Unlike the canonical histones, H2AFZ is associated with highly dynamic regions of the genome, influencing nucleosome positioning and accessibility, which are essential for various cellular processes such as transcription, replication, and DNA repair. Research on H2AFZ has gained momentum due to its implications in development and disease; for instance, aberrations in its expression have been linked to cancers and other disorders. Furthermore, H2AFZ is believed to interact with several transcription factors and epigenetic regulators, thus serving as a potential biomarker for specific pathologies. Understanding the functional mechanisms of H2AFZ through recombinant protein studies can provide insights into its unique properties and interactions within the chromatin landscape. This research is pivotal not only for elucidating the fundamental aspects of epigenetics but also for exploring therapeutic strategies that target histone variants in disease contexts. Overall, the investigation of H2AFZ offers promising avenues for advancing our knowledge of chromatin biology and its intricate roles in health and disease.
