Analytical Data
-
Gene name
HRMT1L4
- Application
-
Alternative Names
ANM8_HUMAN; Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 4 ; Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4; HMT1 hnRNP methyltransferase like 3; HMT1 hnRNP methyltransferase like 4; HRMT1 L3; HRMT1 L4; HRMT1L 3; HRMT1L 4; HRMT1L3; HRMT1L4; prmt8
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NR22
-
Expression Region
61-394aa
-
AA Sequence
MSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
-
Molecular Weight
45.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HRMT1L4, a member of the SET-domain containing family of proteins, has garnered significant interest in recent years due to its involvement in epigenetic regulation and chromatin modification. This protein is believed to play a crucial role in the methylation of histones, which is a fundamental process influencing gene expression, cellular differentiation, and developmental pathways. Dysregulation of HRMT1L4 has been associated with various diseases, including cancers and other pathologies, where altered gene expression patterns are observed. As researchers strive to understand the intricate mechanisms of epigenetic regulation, the recombinant expression of HRMT1L4 provides valuable insight into its functional properties and interactions with other molecular components. By producing this protein in a controlled environment, scientists can study its biochemical characteristics, analyze its role in the context of chromatin dynamics, and explore potential therapeutic implications. The study of HRMT1L4 as a recombinant protein not only sheds light on its influence in normal cellular processes but also enhances our understanding of its aberrations in disease states, potentially paving the way for novel interventions in epigenetic therapies.
