Analytical Data
-
Gene name
PACAP
- Application
-
Alternative Names
PACAP;Pituitary adenylate cyclase-activating polypeptide type I receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P41586
-
Expression Region
21-120aa
-
AA Sequence
MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVG EMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PACAP (Pituitary Adenylate Cyclase-Activating Polypeptide) is a neuropeptide that plays a critical role in various physiological processes, including neuroprotection, neurodevelopment, and the regulation of neuroendocrine functions. Its significance in both the central and peripheral nervous systems has led researchers to explore its potential therapeutic applications in conditions such as neurodegenerative diseases, anxiety, and metabolic disorders. The study of recombinant PACAP proteins has gained traction due to their ability to mimic the natural peptide's functions while allowing for controlled experimental settings. The production of recombinant PACAP through methods such as genetic engineering enables the investigation of its structure-function relationships and interactions with specific receptors, particularly PACAP receptors (PAC1, VPAC1, and VPAC2). Additionally, research into PACAP's signaling pathways and its influence on cellular responses has provided insights into the mechanisms underlying its diverse biological effects. Overall, the study of PACAP recombinant proteins presents opportunities to develop novel therapeutic strategies, enhance our understanding of neurophysiological processes, and offer hope for advancing treatments for various neurological and psychiatric conditions.











