Cat: PA2000-4212

Recombinant Human MEIS1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MEIS1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MEIS1;Homeobox Protein Meis1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00470

  • Expression Region

    1-90aa

  • AA Sequence

    MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQY PHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALI

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MEIS1, a member of the Meis/Pre-B-cell leukemia homeobox (PBX) family of transcription factors, plays a crucial role in various developmental processes, including limb patterning, hematopoiesis, and neurogenesis. Its dysregulation has been linked to several hematological malignancies and developmental disorders. The search for effective therapeutic strategies to target MEIS1 in cancer has gained momentum, particularly as recent studies suggest its involvement in the stemness and differentiation of leukemia stem cells. MEIS1 operates primarily through the regulation of gene expression by interacting with other transcription factors, such as PBX1, and modulating chromatin remodeling. Understanding the molecular mechanisms governing MEIS1 function is critical for deciphering its role in cellular processes and disease states. Recent advances in recombinant protein technologies have enabled the production of MEIS1 in functional forms, facilitating the study of its structure-function relationships and interaction networks in vitro. By generating recombinant MEIS1 protein, researchers aim to elucidate its biological activities and potential as a therapeutic target. This research is significant not only for revealing the complexities of transcriptional regulation in development and cancer but also for opening new avenues for intervention in MEIS1-associated pathologies. As such, the study of MEIS1 recombinant proteins is poised to contribute substantially to our understanding of both fundamental biological mechanisms and the development of novel therapeutic approaches.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US