Analytical Data
-
Gene name
MEIS1
- Application
-
Alternative Names
MEIS1；Homeobox Protein Meis1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00470
-
Expression Region
1-90aa
-
AA Sequence
MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQY PHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALI
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MEIS1, a member of the Meis/Pre-B-cell leukemia homeobox (PBX) family of transcription factors, plays a crucial role in various developmental processes, including limb patterning, hematopoiesis, and neurogenesis. Its dysregulation has been linked to several hematological malignancies and developmental disorders. The search for effective therapeutic strategies to target MEIS1 in cancer has gained momentum, particularly as recent studies suggest its involvement in the stemness and differentiation of leukemia stem cells. MEIS1 operates primarily through the regulation of gene expression by interacting with other transcription factors, such as PBX1, and modulating chromatin remodeling. Understanding the molecular mechanisms governing MEIS1 function is critical for deciphering its role in cellular processes and disease states. Recent advances in recombinant protein technologies have enabled the production of MEIS1 in functional forms, facilitating the study of its structure-function relationships and interaction networks in vitro. By generating recombinant MEIS1 protein, researchers aim to elucidate its biological activities and potential as a therapeutic target. This research is significant not only for revealing the complexities of transcriptional regulation in development and cancer but also for opening new avenues for intervention in MEIS1-associated pathologies. As such, the study of MEIS1 recombinant proteins is poised to contribute substantially to our understanding of both fundamental biological mechanisms and the development of novel therapeutic approaches.
