Analytical Data
-
Gene name
ITGa1
- Application
-
Alternative Names
ITGa1;Integrin alpha-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P56199
-
Expression Region
951-1059aa
-
AA Sequence
QFYSSASEYHISIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPEL KLSISFPNMTSNGYPVLYPTGLSSSENANCRPHIFEDPFSINSGKKMTTS TDHLKRGTI
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ITGa1, or integrin alpha 1, is a key protein involved in cell adhesion and signaling processes, playing a pivotal role in various physiological and pathological conditions. Its primary function is to form heterodimeric integrins with beta subunits, facilitating attachment of cells to the extracellular matrix. This adhesion is crucial for processes such as tissue development, immune response, and wound healing. Recent research has illuminated the significance of ITGa1 in tumor biology, where its expression levels and activity have been correlated with cancer metastasis and progression. In addition, ITGa1's interactions with specific extracellular matrix components suggest its involvement in modulating the tumor microenvironment, influencing cell migration and invasion. The study of ITGa1 recombinant proteins has become a focal point for developing therapeutic strategies, aiming to manipulate its function in various diseases, including fibrotic disorders and cancers. Understanding the structure-function relationship of ITGa1 through recombinant protein studies can provide insights into its mechanistic roles, paving the way for potential interventions that target integrin-mediated processes in disease contexts. As research advances, ITGa1 emerges as a promising biomarker and therapeutic target, underscoring the importance of recombinant proteins in elucidating complex biological systems and developing new treatment modalities.











