Cat: PA2000-144DB

Recombinant Human ITGa1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ITGa1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ITGa1;Integrin alpha-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P56199

  • Expression Region

    951-1059aa

  • AA Sequence

    QFYSSASEYHISIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPEL KLSISFPNMTSNGYPVLYPTGLSSSENANCRPHIFEDPFSINSGKKMTTS TDHLKRGTI

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ITGa1, or integrin alpha 1, is a key protein involved in cell adhesion and signaling processes, playing a pivotal role in various physiological and pathological conditions. Its primary function is to form heterodimeric integrins with beta subunits, facilitating attachment of cells to the extracellular matrix. This adhesion is crucial for processes such as tissue development, immune response, and wound healing. Recent research has illuminated the significance of ITGa1 in tumor biology, where its expression levels and activity have been correlated with cancer metastasis and progression. In addition, ITGa1's interactions with specific extracellular matrix components suggest its involvement in modulating the tumor microenvironment, influencing cell migration and invasion. The study of ITGa1 recombinant proteins has become a focal point for developing therapeutic strategies, aiming to manipulate its function in various diseases, including fibrotic disorders and cancers. Understanding the structure-function relationship of ITGa1 through recombinant protein studies can provide insights into its mechanistic roles, paving the way for potential interventions that target integrin-mediated processes in disease contexts. As research advances, ITGa1 emerges as a promising biomarker and therapeutic target, underscoring the importance of recombinant proteins in elucidating complex biological systems and developing new treatment modalities.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US