Analytical Data
-
Gene name
GZMK
- Application
-
Alternative Names
GZMK;TRYP2;Granzyme K
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49863
-
Expression Region
27-264aa
-
AA Sequence
IIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQ SPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAA KLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVL SRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHA IVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GZMK, or Granzyme K, is a serine protease predominantly expressed in cytotoxic T cells and natural killer (NK) cells, playing a critical role in the immune response by inducing apoptosis in target cells. The study of GZMK recombinantly expressed proteins has gained significant attention due to their potential therapeutic applications, particularly in cancer immunotherapy and infectious diseases. Understanding the structure and function of GZMK can provide insights into its mechanisms of action, including its role in the granule exocytosis pathway and the cleavage of specific substrates vital for immune regulation. Additionally, recombinant GZMK can be utilized to investigate its effects in various cellular contexts, thereby aiding in the development of novel immune modulators and enhancing the efficacy of existing treatments. Research on GZMK is further propelled by its involvement in chronic inflammatory conditions and autoimmune diseases, where its dysregulation may contribute to pathogenesis. Overall, the exploration of GZMK recombinant proteins not only enhances our comprehension of immune dynamics but also opens avenues for innovative therapeutic strategies targeting immune-mediated disorders.











