Analytical Data
-
Gene name
GTF3C6
- Application
-
Alternative Names
GTF3C6;C6orf51;General transcription factor 3C polypeptide 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q969F1
-
Expression Region
1-213aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAAAADERSPEDGEDEEEEEQLVLVEL SGIIDSDFLSKCENKCKVLGIDTERPILQVDSCVFAGEYEDTLGTCVIFE ENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENIGGVEWLQ IKDNDFSYRPNMICNFLHENEDEEVVASAPDKSLELEEEEIQMNDSSNLS CEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GTF3C6, or General Transcription Factor 3C Subunit 6, is a critical component of the transcription machinery in eukaryotic cells, playing a vital role in the recruitment of RNA polymerase II to gene promoters during the initiation of transcription. Abnormalities in GTF3C6 have been implicated in various diseases, including certain cancers and genetic disorders, making it a target of interest for research aimed at understanding the mechanisms of gene regulation. Given its pivotal role in transcription, the recombinant production of GTF3C6 is essential for studying its structure, function, and interactions with other regulatory proteins. The generation of GTF3C6 as a recombinant protein allows researchers to perform biophysical assays, crystallography studies, and functional assays, enhancing our knowledge of its involvement in the transcriptional regulation process. Additionally, understanding the protein's interactions within the transcription complex can lead to insights into the broader regulatory networks governing gene expression, potentially unveiling new therapeutic avenues for diseases associated with transcriptional dysregulation. Thus, ongoing research into GTF3C6 not only deepens our fundamental understanding of gene transcription but also opens up possibilities for innovative strategies in molecular medicine.
