Analytical Data
-
Gene name
HPS3
- Application
-
Alternative Names
HPS3; Hermansky-Pudlak syndrome 3 protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q969F9
-
Expression Region
1-372aa
-
AA Sequence
MFYVAEPKQVPHILCSPSMKNINPLTAMSYLRKLDTSGFSSILVTLTKAAVALKMGDLDMHRNEMKSHSEMKLVCGFILEPRLLIQQRKGQIVPTELALHLKETQPGLLVASVLGLQKNNKIGIEEADSFFKVLCAKDEDTIPQLLVDFWEAQLVACLPDVVLQELFFKLTSQYIWRLSKRQPPDTTPLRTSEDLINACSHYGLIYPWVHVVISSDSLADKNYTEDLSKLQSLICGPSFDIASIIPFLEPLSEDTIAGLSVHVLCRTRLKEYEQCIDILLERCPEAVIPYANHELKEENRTLWWKKLLPELCQRIKCGGEKYQLYLSSLKETLSIVAVELELKDFMNVLPEDGTATFFLPYLLYCSRKKPLT
-
Molecular Weight
68.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The HPS3 gene, associated with Hermansky-Pudlak Syndrome (HPS), encodes a protein involved in lysosomal trafficking and pigment granule biogenesis. HPS is a rare autosomal recessive disorder characterized by albinism, bleeding tendency, and pulmonary fibrosis, stemming from defects in lysosomal-related organelles. Research on HPS3 recombinant protein focuses on understanding the molecular mechanisms underlying these dysfunctional pathways. Investigating the structure and function of the HPS3 protein can shed light on its role in melanosome formation and immune responses, as well as its interaction with other proteins in the biogenesis of lysosome-related organelles. Moreover, such studies may facilitate the development of targeted therapies for individuals affected by HPS and similar lysosomal storage disorders. By generating HPS3 recombinant proteins for functional assays and structural analyses, researchers aim to elucidate the protein’s specific biological actions and identify potential pharmacological targets that could mitigate the symptoms of HPS. The insights gained from this research not only enhance our comprehension of HPS but also contribute to broader knowledge in cell biology, particularly concerning organelle dynamics and the consequences of their dysfunction.
