Analytical Data
-
Gene name
HOXB6
- Application
-
Alternative Names
HGNC:5117; Homeo box 2B; homeo box B6; Homeobox B6; Homeobox protein Hox B6; Homeobox protein Hox-2.2; Homeobox protein Hox-2B; Homeobox protein Hox-B6; Homeobox protein Hu-2; Hox-2.2; HOX2; HOX2B; hoxb6; HU-2; HXB6_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17509
-
Expression Region
1-224aa
-
AA Sequence
MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKQAE
-
Molecular Weight
50.27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HOXB6, belonging to the homeobox gene family, plays a crucial role in the regulation of embryonic development and cell differentiation. This gene is involved in the modulation of various biological processes, including limb patterning and the formation of specific tissues. Abnormal expression of HOXB6 has been implicated in several diseases, particularly in oncogenesis, as it can influence cell proliferation and apoptosis. Recent studies have indicated that HOXB6 may serve as a potential biomarker for certain cancers and could provide insights into tumor progression and metastasis. Given the relevance of HOXB6 in both developmental biology and cancer research, the production of recombinant HOXB6 protein has garnered significant attention. The ability to express and purify HOXB6 in a laboratory setting enables researchers to investigate its functional roles, interactions with other proteins, and its influence on cellular pathways. Understanding the mechanisms of HOXB6 action may lead to novel therapeutic strategies and enhance our comprehension of developmental disorders and cancer biology. Consequently, the recombinant HOXB6 protein is a valuable tool for advancing research in these fields, providing a platform for experimental studies that could pave the way for future clinical applications.
