Analytical Data
-
Gene name
CHRNa1
- Application
-
Alternative Names
CHRNa1；ACHRA；CHNRA；Acetylcholine receptor subunit alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02708
-
Expression Region
21-255aa
-
AA Sequence
SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIV TTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGV KKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFK SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGE WVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL
-
Molecular Weight
44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cholinergic receptors, specifically the nicotinic acetylcholine receptors (nAChRs), play a crucial role in synaptic transmission and are involved in various physiological functions such as muscle contraction, cognitive processes, and modulation of neurotransmitter release. Among them, the α1 subunit of the nAChR (CHRNa1) has garnered significant interest due to its ubiquitous expression in the nervous system and its implication in various neurological disorders. Research on CHRNa1 recombinant proteins focuses on understanding their biophysical properties, pharmacological profiles, and interaction with ligands. This is particularly important for drug development targeting conditions such as Alzheimer's disease, Parkinson's disease, and nicotine addiction. Advances in recombinant DNA technology have enabled the production and purification of CHRNa1 proteins, allowing for detailed studies of their structure-function relationships. Additionally, these recombinant proteins serve as valuable tools for high-throughput screening of novel compounds and for elucidating the mechanisms underlying receptor activation and signaling pathways. Overall, the study of CHRNa1 recombinant proteins represents a vital component in the broader field of neuropharmacology, aiming to provide insights into receptor behavior and facilitate the development of targeted therapies for cholinergic dysfunctions.
