Analytical Data
-
Gene name
GOLPH3
- Application
-
Alternative Names
GOLPH3；GPP34；Golgi phosphoProtein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H4A6
-
Expression Region
1-298aa
-
AA Sequence
MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
-
Molecular Weight
39.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GOLPH3, or Golgi phosphoprotein 3, is a protein that plays a pivotal role in the regulation of Golgi morphology and function, implicating it in various cellular processes, including vesicle transport, glycosylation, and signal transduction. Recent studies have highlighted its involvement in cancer progression, as GOLPH3 is often overexpressed in various malignancies, suggesting a potential oncogenic role. The protein interacts with several key signaling pathways, including mTOR, which regulates cell growth and proliferation. The understanding of GOLPH3's function and its contributions to tumorigenesis has led to increased interest in developing GOLPH3 as a biomarker for cancer diagnosis and prognosis, as well as a potential therapeutic target. The production of recombinant GOLPH3 protein has become essential for elucidating its molecular mechanisms and interactions. By generating and studying this recombinant protein, researchers aim to delineate the structural features that contribute to its function and role in disease, thereby providing insights that may lead to innovative strategies for cancer treatment and improved patient outcomes.
